SCOPe 2.05: Domain d2w7wa1: 2w7w A:2-83

Lineage for d2w7wa1 (2w7w A:2-83)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (31 species)
   not a true protein

7. Species Aliivibrio salmonicida [TaxId:316275] [225612] (1 PDB entry)

8. Domain d2w7wa1: 2w7w A:2-83 [206702]
   Other proteins in same PDB: d2w7wa2, d2w7wb2
   automated match to d1isca1
   complexed with fe

Details for d2w7wa1

PDB Entry: 2w7w, 1.7 Å

PDB Description: the crystal structure of iron superoxide dismutase from aliivibrio salmonicida.

PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2w7wa1:

Sequence; same for both SEQRES and ATOM records:

>d2w7wa1 a.2.11.0 (A:2-83) automated matches {Aliivibrio salmonicida [TaxId: 316275]}
sfelpalpfakdalephisaetldyhhgkhhntyvvklnglipgtefegktleeiiktst
ggvfnnaaqiwnhtfywnclap

Timeline for d2w7wa1:

• d2w7wa1 first appeared in SCOPe 2.03
  
• d2w7wa1 appears in SCOPe 2.04
  
• d2w7wa1 appears in SCOPe 2.06
  
• d2w7wa1 appears in the current release, SCOPe 2.08