Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (31 species) not a true protein |
Species Aliivibrio salmonicida [TaxId:316275] [225612] (1 PDB entry) |
Domain d2w7wa1: 2w7w A:2-83 [206702] Other proteins in same PDB: d2w7wa2, d2w7wb2 automated match to d1isca1 complexed with fe |
PDB Entry: 2w7w (more details), 1.7 Å
SCOPe Domain Sequences for d2w7wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w7wa1 a.2.11.0 (A:2-83) automated matches {Aliivibrio salmonicida [TaxId: 316275]} sfelpalpfakdalephisaetldyhhgkhhntyvvklnglipgtefegktleeiiktst ggvfnnaaqiwnhtfywnclap
Timeline for d2w7wa1: