SCOPe 2.07: Domain d1bmga_: 1bmg A:

Lineage for d1bmga_ (1bmg A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries)

8. Domain d1bmga_: 1bmg A: [20667]

Details for d1bmga_

PDB Entry: 1bmg, 2.5 Å

PDB Description: crystal structure of bovine beta2-microglobulin

PDB Compounds: (A:) beta=2=-microglobulin

SCOPe Domain Sequences for d1bmga_:

Sequence; same for both SEQRES and ATOM records:

>d1bmga_ b.1.1.2 (A:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl

Timeline for d1bmga_:

• d1bmga_ first appeared (with stable ids) in SCOP 1.55, called d1bmg__
  
• d1bmga_ appears in SCOPe 2.06
  
• d1bmga_ appears in the current release, SCOPe 2.08