Lineage for d1bmga_ (1bmg A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 783931Species Cow (Bos taurus) [TaxId:9913] [48946] (1 PDB entry)
  8. 783932Domain d1bmga_: 1bmg A: [20667]

Details for d1bmga_

PDB Entry: 1bmg (more details), 2.5 Å

PDB Description: crystal structure of bovine beta2-microglobulin
PDB Compounds: (A:) beta=2=-microglobulin

SCOP Domain Sequences for d1bmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmga_ b.1.1.2 (A:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl

SCOP Domain Coordinates for d1bmga_:

Click to download the PDB-style file with coordinates for d1bmga_.
(The format of our PDB-style files is described here.)

Timeline for d1bmga_: