Lineage for d1bmg__ (1bmg -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548301Species Cow (Bos taurus) [TaxId:9913] [48946] (1 PDB entry)
  8. 548302Domain d1bmg__: 1bmg - [20667]

Details for d1bmg__

PDB Entry: 1bmg (more details), 2.5 Å

PDB Description: crystal structure of bovine beta2-microglobulin

SCOP Domain Sequences for d1bmg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmg__ b.1.1.2 (-) beta2-microglobulin {Cow (Bos taurus)}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl

SCOP Domain Coordinates for d1bmg__:

Click to download the PDB-style file with coordinates for d1bmg__.
(The format of our PDB-style files is described here.)

Timeline for d1bmg__: