![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries) |
![]() | Domain d1frtb_: 1frt B: [20666] Other proteins in same PDB: d1frta1, d1frta2, d1frtc1, d1frtc2 complexed with fuc, gal, man, nag |
PDB Entry: 1frt (more details), 4.5 Å
SCOP Domain Sequences for d1frtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frtb_ b.1.1.2 (B:) beta2-microglobulin {Rat (Rattus norvegicus) [TaxId: 10116]} iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
Timeline for d1frtb_:
![]() Domains from other chains: (mouse over for more information) d1frta1, d1frta2, d1frtc1, d1frtc2 |