Lineage for d1frtb_ (1frt B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288544Protein beta2-microglobulin [88600] (4 species)
  7. 288719Species Rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries)
  8. 288728Domain d1frtb_: 1frt B: [20666]
    Other proteins in same PDB: d1frta1, d1frta2, d1frtc1, d1frtc2
    complexed with fuc, gal, man, nag

Details for d1frtb_

PDB Entry: 1frt (more details), 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc

SCOP Domain Sequences for d1frtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frtb_ b.1.1.2 (B:) beta2-microglobulin {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d1frtb_:

Click to download the PDB-style file with coordinates for d1frtb_.
(The format of our PDB-style files is described here.)

Timeline for d1frtb_: