SCOPe 2.06: Domain d1frta1: 1frt A:179-269

Lineage for d1frta1 (1frt A:179-269)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries)

8. Domain d1frta1: 1frt A:179-269 [20665]
   Other proteins in same PDB: d1frta2, d1frtb_, d1frtc1, d1frtc2
   complexed with nag

Details for d1frta1

PDB Entry: 1frt, 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc

PDB Compounds: (A:) neonatal fc receptor

SCOPe Domain Sequences for d1frta1:

Sequence; same for both SEQRES and ATOM records:

>d1frta1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

Timeline for d1frta1:

• d1frta1 first appeared (with stable ids) in SCOP 1.55
  
• d1frta1 appears in SCOPe 2.05
  
• d1frta1 appears in SCOPe 2.07
  
• d1frta1 appears in the current release, SCOPe 2.08