Lineage for d1frta1 (1frt A:179-269)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655063Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species)
  7. 655066Species Rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries)
  8. 655071Domain d1frta1: 1frt A:179-269 [20665]
    Other proteins in same PDB: d1frta2, d1frtb_, d1frtc1, d1frtc2
    complexed with fuc, gal, man, nag

Details for d1frta1

PDB Entry: 1frt (more details), 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc
PDB Compounds: (A:) neonatal fc receptor

SCOP Domain Sequences for d1frta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frta1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOP Domain Coordinates for d1frta1:

Click to download the PDB-style file with coordinates for d1frta1.
(The format of our PDB-style files is described here.)

Timeline for d1frta1: