Lineage for d1i1ab_ (1i1a B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220869Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)
  7. 220870Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)
  8. 220878Domain d1i1ab_: 1i1a B: [20664]
    Other proteins in same PDB: d1i1aa2, d1i1ac1, d1i1ac2, d1i1ad1, d1i1ad2
    complexed with cys, fuc, man, nag; mutant

Details for d1i1ab_

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

SCOP Domain Sequences for d1i1ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ab_ b.1.1.2 (B:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d1i1ab_:

Click to download the PDB-style file with coordinates for d1i1ab_.
(The format of our PDB-style files is described here.)

Timeline for d1i1ab_: