Lineage for d1i1ab1 (1i1a B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159213Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)
  7. 159214Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)
  8. 159222Domain d1i1ab1: 1i1a B: [20664]
    Other proteins in same PDB: d1i1aa2, d1i1ac1, d1i1ac2, d1i1ad1, d1i1ad2

Details for d1i1ab1

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

SCOP Domain Sequences for d1i1ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ab1 b.1.1.2 (B:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d1i1ab1:

Click to download the PDB-style file with coordinates for d1i1ab1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ab1: