SCOPe 2.04: Domain d2w57b_: 2w57 B:

Lineage for d2w57b_ (2w57 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [225592] (1 PDB entry)

8. Domain d2w57b_: 2w57 B: [206629]
   automated match to d3eyyb_
   complexed with zn

Details for d2w57b_

PDB Entry: 2w57, 2.6 Å

PDB Description: crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the dna-binding domains

PDB Compounds: (B:) ferric uptake regulation protein

SCOPe Domain Sequences for d2w57b_:

Sequence; same for both SEQRES and ATOM records:

>d2w57b_ a.4.5.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
dnnqalkdaglkvtlprlkilevlqqpecqhisaeelykklidlgeeiglatvyrvlnqf
ddagivtrhhfeggksvfelstqhhhdhlvcldcgeviefsddvieqrqkeiaakynvql
tnhslylygkc

Timeline for d2w57b_:

• d2w57b_ first appeared in SCOPe 2.03
  
• d2w57b_ appears in SCOPe 2.05
  
• d2w57b_ appears in the current release, SCOPe 2.08