SCOPe 2.07: Domain d2w4xa2: 2w4x A:127-436

Lineage for d2w4xa2 (2w4x A:127-436)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (8 PDB entries)
   Uniprot Q89ZI2 148-457

8. Domain d2w4xa2: 2w4x A:127-436 [206626]
   Other proteins in same PDB: d2w4xa1, d2w4xa3
   automated match to d2j47a2
   complexed with ca, gol, stz

Details for d2w4xa2

PDB Entry: 2w4x, 2.42 Å

PDB Description: btgh84 in complex with stz

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2w4xa2:

Sequence; same for both SEQRES and ATOM records:

>d2w4xa2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

Timeline for d2w4xa2:

• d2w4xa2 first appeared in SCOPe 2.03
  
• d2w4xa2 appears in SCOPe 2.06
  
• d2w4xa2 appears in the current release, SCOPe 2.08