Lineage for d2w4xa2 (2w4x A:127-436)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440813Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2440834Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)
  7. 2440835Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (8 PDB entries)
    Uniprot Q89ZI2 148-457
  8. 2440842Domain d2w4xa2: 2w4x A:127-436 [206626]
    Other proteins in same PDB: d2w4xa1, d2w4xa3
    automated match to d2j47a2
    complexed with ca, gol, stz

Details for d2w4xa2

PDB Entry: 2w4x (more details), 2.42 Å

PDB Description: btgh84 in complex with stz
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2w4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w4xa2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

SCOPe Domain Coordinates for d2w4xa2:

Click to download the PDB-style file with coordinates for d2w4xa2.
(The format of our PDB-style files is described here.)

Timeline for d2w4xa2: