SCOP 1.57: Domain d3fruf1: 3fru F:

Lineage for d3fruf1 (3fru F:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)

8. Domain d3fruf1: 3fru F: [20662]
   Other proteins in same PDB: d3frua2, d3fruc2, d3frue2

Details for d3fruf1

PDB Entry: 3fru, 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3fruf1:

Sequence; same for both SEQRES and ATOM records:

>d3fruf1 b.1.1.2 (F:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

Timeline for d3fruf1:

• d3fruf1 first appeared (with stable ids) in SCOP 1.55
  
• d3fruf1 appears in SCOP 1.59
  
• d3fruf1 appears in the current release, SCOPe 2.08, called d3fruf_