Lineage for d3frue1 (3fru E:179-269)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655063Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species)
  7. 655066Species Rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries)
  8. 655069Domain d3frue1: 3fru E:179-269 [20661]
    Other proteins in same PDB: d3frua2, d3frub_, d3fruc2, d3frud_, d3frue2, d3fruf_
    complexed with bme, fuc, gal, man, nag, so4

Details for d3frue1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5
PDB Compounds: (E:) neonatal fc receptor

SCOP Domain Sequences for d3frue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frue1 b.1.1.2 (E:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOP Domain Coordinates for d3frue1:

Click to download the PDB-style file with coordinates for d3frue1.
(The format of our PDB-style files is described here.)

Timeline for d3frue1: