Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries) |
Domain d3frud1: 3fru D: [20660] Other proteins in same PDB: d3frua2, d3fruc2, d3frue2 |
PDB Entry: 3fru (more details), 2.2 Å
SCOP Domain Sequences for d3frud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3frud1 b.1.1.2 (D:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)} iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
Timeline for d3frud1: