Lineage for d3frud1 (3fru D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159213Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)
  7. 159214Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)
  8. 159218Domain d3frud1: 3fru D: [20660]
    Other proteins in same PDB: d3frua2, d3fruc2, d3frue2

Details for d3frud1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3frud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frud1 b.1.1.2 (D:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d3frud1:

Click to download the PDB-style file with coordinates for d3frud1.
(The format of our PDB-style files is described here.)

Timeline for d3frud1: