SCOPe 2.04: Domain d2w2dd1: 2w2d D:449-547

Lineage for d2w2dd1 (2w2d D:449-547)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (12 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [193827] (5 PDB entries)

8. Domain d2w2dd1: 2w2d D:449-547 [206576]
   Other proteins in same PDB: d2w2db2, d2w2dd2
   automated match to d3btaa3
   complexed with act, cl, gol, so4, zn

Details for d2w2dd1

PDB Entry: 2w2d, 2.59 Å

PDB Description: crystal structure of a catalytically active, non-toxic endopeptidase derivative of clostridium botulinum toxin a

PDB Compounds: (D:) botulinum neurotoxin a heavy chain

SCOPe Domain Sequences for d2w2dd1:

Sequence; same for both SEQRES and ATOM records:

>d2w2dd1 d.92.1.0 (D:449-547) automated matches {Clostridium botulinum [TaxId: 1491]}
alnlqcikvnnwdlffspsednftndlnkgeeitsdtnieaaeenisldliqqyyltfnf
dnepenisienlssdiigqlelmpnierfpngkkyeldk

Timeline for d2w2dd1:

• d2w2dd1 first appeared in SCOPe 2.03
  
• d2w2dd1 appears in SCOPe 2.05
  
• d2w2dd1 appears in the current release, SCOPe 2.08