SCOPe 2.03: Domain d2w0fc_: 2w0f C:

Lineage for d2w0fc_ (2w0f C:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (2 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (9 PDB entries)

8. Domain d2w0fc_: 2w0f C: [206552]
   Other proteins in same PDB: d2w0fa1, d2w0fa2, d2w0fb1, d2w0fb2
   automated match to d1s5hc_
   complexed with co, dga, f09, hx0, k

Details for d2w0fc_

PDB Entry: 2w0f, 2.4 Å

PDB Description: Potassium Channel KcsA-Fab Complex with Tetraoctylammonium

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2w0fc_:

Sequence; same for both SEQRES and ATOM records:

>d2w0fc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2w0fc_:

• d2w0fc_ is new in SCOPe 2.03-stable
  
• d2w0fc_ appears in SCOPe 2.04
  
• d2w0fc_ appears in the current release, SCOPe 2.07