Lineage for d1dqtc_ (1dqt C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288384Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)
  7. 288391Species Mouse (Mus musculus) [TaxId:10090] [48941] (1 PDB entry)
  8. 288394Domain d1dqtc_: 1dqt C: [20655]

Details for d1dqtc_

PDB Entry: 1dqt (more details), 2 Å

PDB Description: the crystal structure of murine ctla4 (cd152)

SCOP Domain Sequences for d1dqtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqtc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus)}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp

SCOP Domain Coordinates for d1dqtc_:

Click to download the PDB-style file with coordinates for d1dqtc_.
(The format of our PDB-style files is described here.)

Timeline for d1dqtc_: