Lineage for d1dqtc_ (1dqt C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158666Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)
  7. 158673Species Mouse (Mus musculus) [TaxId:10090] [48941] (1 PDB entry)
  8. 158676Domain d1dqtc_: 1dqt C: [20655]

Details for d1dqtc_

PDB Entry: 1dqt (more details), 2 Å

PDB Description: the crystal structure of murine ctla4 (cd152)

SCOP Domain Sequences for d1dqtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqtc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus)}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp

SCOP Domain Coordinates for d1dqtc_:

Click to download the PDB-style file with coordinates for d1dqtc_.
(The format of our PDB-style files is described here.)

Timeline for d1dqtc_: