Lineage for d1dqtc_ (1dqt C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741777Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)
  7. 2741790Species Mouse (Mus musculus) [TaxId:10090] [48941] (3 PDB entries)
  8. 2741794Domain d1dqtc_: 1dqt C: [20655]
    complexed with cl, edo

Details for d1dqtc_

PDB Entry: 1dqt (more details), 2 Å

PDB Description: the crystal structure of murine ctla4 (cd152)
PDB Compounds: (C:) cytotoxic t lymphocyte associated antigen 4

SCOPe Domain Sequences for d1dqtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqtc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp

SCOPe Domain Coordinates for d1dqtc_:

Click to download the PDB-style file with coordinates for d1dqtc_.
(The format of our PDB-style files is described here.)

Timeline for d1dqtc_: