Lineage for d1dqtb_ (1dqt B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52796Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)
  7. 52803Species Mouse (Mus musculus) [TaxId:10090] [48941] (1 PDB entry)
  8. 52805Domain d1dqtb_: 1dqt B: [20654]

Details for d1dqtb_

PDB Entry: 1dqt (more details), 2 Å

PDB Description: the crystal structure of murine ctla4 (cd152)

SCOP Domain Sequences for d1dqtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqtb_ b.1.1.1 (B:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus)}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp

SCOP Domain Coordinates for d1dqtb_:

Click to download the PDB-style file with coordinates for d1dqtb_.
(The format of our PDB-style files is described here.)

Timeline for d1dqtb_: