Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48941] (3 PDB entries) |
Domain d1dqtb_: 1dqt B: [20654] complexed with cl, edo |
PDB Entry: 1dqt (more details), 2 Å
SCOPe Domain Sequences for d1dqtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqtb_ b.1.1.1 (B:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
Timeline for d1dqtb_: