SCOPe 2.07: Domain d2vxvl2: 2vxv L:108-213

Lineage for d2vxvl2 (2vxv L:108-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d2vxvl2: 2vxv L:108-213 [206531]
   Other proteins in same PDB: d2vxvl1
   automated match to d1rhha2
   complexed with cxs, gol

Details for d2vxvl2

PDB Entry: 2vxv, 1.49 Å

PDB Description: crystal structure of human igg abt-325 fab fragment

PDB Compounds: (L:) human igg abt-325

SCOPe Domain Sequences for d2vxvl2:

Sequence; same for both SEQRES and ATOM records:

>d2vxvl2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d2vxvl2:

• d2vxvl2 first appeared in SCOPe 2.03
  
• d2vxvl2 appears in SCOPe 2.06
  
• d2vxvl2 appears in the current release, SCOPe 2.08