SCOPe 2.03: Domain d2vxvl1: 2vxv L:1-107

Lineage for d2vxvl1 (2vxv L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d2vxvl1: 2vxv L:1-107 [206530]
   Other proteins in same PDB: d2vxvl2
   automated match to d1rhha1
   complexed with cxs, gol

Details for d2vxvl1

PDB Entry: 2vxv, 1.49 Å

PDB Description: crystal structure of human igg abt-325 fab fragment

PDB Compounds: (L:) human igg abt-325

SCOPe Domain Sequences for d2vxvl1:

Sequence; same for both SEQRES and ATOM records:

>d2vxvl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqspatlsvspgeratlscrasesissnlawyqqkpgqaprlfiytastratdipa
rfsgsgsgteftltisslqsedfavyycqqynnwpsitfgqgtrleik

Timeline for d2vxvl1:

• d2vxvl1 is new in SCOPe 2.03-stable
  
• d2vxvl1 appears in SCOPe 2.04
  
• d2vxvl1 appears in the current release, SCOPe 2.08