Lineage for d2vxso2 (2vxs O:109-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750883Domain d2vxso2: 2vxs O:109-212 [206525]
    Other proteins in same PDB: d2vxsh_, d2vxsi_, d2vxsj_, d2vxsk_, d2vxsl1, d2vxsm1, d2vxsn1, d2vxso1
    automated match to d1adql2
    complexed with so4

Details for d2vxso2

PDB Entry: 2vxs (more details), 2.63 Å

PDB Description: structure of il-17a in complex with a potent, fully human neutralising antibody
PDB Compounds: (O:) fab fragment

SCOPe Domain Sequences for d2vxso2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxso2 b.1.1.2 (O:109-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d2vxso2:

Click to download the PDB-style file with coordinates for d2vxso2.
(The format of our PDB-style files is described here.)

Timeline for d2vxso2: