Lineage for d2vxso1 (2vxs O:2-108)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367237Domain d2vxso1: 2vxs O:2-108 [206524]
    Other proteins in same PDB: d2vxsl2, d2vxsm2, d2vxsn2, d2vxso2
    automated match to d1adql1
    complexed with so4

Details for d2vxso1

PDB Entry: 2vxs (more details), 2.63 Å

PDB Description: structure of il-17a in complex with a potent, fully human neutralising antibody
PDB Compounds: (O:) fab fragment

SCOPe Domain Sequences for d2vxso1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxso1 b.1.1.0 (O:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvpd
rfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlg

SCOPe Domain Coordinates for d2vxso1:

Click to download the PDB-style file with coordinates for d2vxso1.
(The format of our PDB-style files is described here.)

Timeline for d2vxso1: