SCOPe 2.04: Domain d2vxsm1: 2vxs M:1-108

Lineage for d2vxsm1 (2vxs M:1-108)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2vxsm1: 2vxs M:1-108 [206520]
   Other proteins in same PDB: d2vxsl2, d2vxsm2, d2vxsn2, d2vxso2
   automated match to d1adql1
   complexed with so4

Details for d2vxsm1

PDB Entry: 2vxs, 2.63 Å

PDB Description: structure of il-17a in complex with a potent, fully human neutralising antibody

PDB Compounds: (M:) fab fragment

SCOPe Domain Sequences for d2vxsm1:

Sequence; same for both SEQRES and ATOM records:

>d2vxsm1 b.1.1.0 (M:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlg

Timeline for d2vxsm1:

• d2vxsm1 first appeared in SCOPe 2.03
  
• d2vxsm1 appears in SCOPe 2.05
  
• d2vxsm1 appears in the current release, SCOPe 2.08