Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (46 species) not a true protein |
Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [225524] (4 PDB entries) |
Domain d2vx7a_: 2vx7 A: [206517] automated match to d1odza_ complexed with mab, na |
PDB Entry: 2vx7 (more details), 1.8 Å
SCOPe Domain Sequences for d2vx7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vx7a_ c.1.8.0 (A:) automated matches {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} lpalidtqataetralyrnlaklrykhllfghedslaygvhwegdmdrsdvrdvtganpa vygwelgglelghtanldavnfekmqhwikagysrggvitiswhvfnpvsggnswdktpa vhelipggarhatlkayldtfvafnegladvdaqgnkhyppiifrpwhehngdwfwwgkg haseqdyialwrftvhylrdekklrnliyayspdrsridmanfeagylygypgdayvdii gldnywdvgheantasadeqkaaltaslkqlvqiarskgkiaaltatgnnrltidnfwte rllgpisadadaseiayvmvwrnanlarekseqffapfpgqataddfkrfyqsevvlfed elpplyr
Timeline for d2vx7a_: