Lineage for d1tvda_ (1tvd A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288452Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 288477Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (2 PDB entries)
  8. 288478Domain d1tvda_: 1tvd A: [20650]

Details for d1tvda_

PDB Entry: 1tvd (more details), 1.9 Å

PDB Description: variable domain of t cell receptor delta chain

SCOP Domain Sequences for d1tvda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain}
dkvtqsspdqtvasgsevvllctydtvysnpdlfwyrirpdysfqfvfygddsrsegadf
tqgrfsvkhiltqkafhlvispvrtedsatyycaftlppptdklifgkgtrvtvep

SCOP Domain Coordinates for d1tvda_:

Click to download the PDB-style file with coordinates for d1tvda_.
(The format of our PDB-style files is described here.)

Timeline for d1tvda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tvdb_