Lineage for d1tvda_ (1tvd A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein T-cell antigen receptor [48933] (5 species) 
Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (1 PDB entry) 
Domain d1tvda_: 1tvd A: [20650]
Details for d1tvda_
PDB Entry: 1tvd (more details), 1.9 Å
PDB Description: variable domain of t cell receptor delta chain
SCOP Domain Sequences for d1tvda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain}
dkvtqsspdqtvasgsevvllctydtvysnpdlfwyrirpdysfqfvfygddsrsegadf
tqgrfsvkhiltqkafhlvispvrtedsatyycaftlppptdklifgkgtrvtvep
SCOP Domain Coordinates for d1tvda_:
Click to download the PDB-style file with coordinates for d1tvda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tvda_:
- d1tvda_ appears in SCOP 1.57
- d1tvda_ appears in the current release, SCOPe 2.08
View in 3D
