Lineage for d2vurb2 (2vur B:179-495)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570523Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 1570558Protein Hyaluronidase catalytic domain [141792] (1 species)
  7. 1570559Species Clostridium perfringens [TaxId:1502] [141793] (7 PDB entries)
    Uniprot Q8XL08 179-495
  8. 1570569Domain d2vurb2: 2vur B:179-495 [206492]
    Other proteins in same PDB: d2vura1, d2vura3, d2vurb1, d2vurb3
    automated match to d2cbia2
    complexed with so4, yx1

Details for d2vurb2

PDB Entry: 2vur (more details), 2.2 Å

PDB Description: chemical dissection of the link between streptozotocin, o-glcnac and pancreatic cell death
PDB Compounds: (B:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2vurb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vurb2 c.1.8.10 (B:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

SCOPe Domain Coordinates for d2vurb2:

Click to download the PDB-style file with coordinates for d2vurb2.
(The format of our PDB-style files is described here.)

Timeline for d2vurb2: