Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
Protein Hyaluronidase N-terminal domain [143619] (1 species) |
Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries) Uniprot Q8XL08 41-178 |
Domain d2vurb1: 2vur B:41-178 [206491] Other proteins in same PDB: d2vura2, d2vura3, d2vurb2, d2vurb3 automated match to d2cbia3 complexed with so4, yx1 |
PDB Entry: 2vur (more details), 2.2 Å
SCOPe Domain Sequences for d2vurb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vurb1 d.92.2.3 (B:41-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]} vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk qlvkesnipevnitdypt
Timeline for d2vurb1: