Lineage for d1qsfe1 (1qsf E:3-118)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105447Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1105470Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 1105501Domain d1qsfe1: 1qsf E:3-118 [20649]
    Other proteins in same PDB: d1qsfa1, d1qsfa2, d1qsfb_, d1qsfd2, d1qsfe2

Details for d1qsfe1

PDB Entry: 1qsf (more details), 2.8 Å

PDB Description: structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a
PDB Compounds: (E:) hman T-cell receptor

SCOPe Domain Sequences for d1qsfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsfe1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

SCOPe Domain Coordinates for d1qsfe1:

Click to download the PDB-style file with coordinates for d1qsfe1.
(The format of our PDB-style files is described here.)

Timeline for d1qsfe1: