Lineage for d1qsfe1 (1qsf E:3-118)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein T-cell antigen receptor [48933] (5 species) 
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (6 PDB entries) 
Domain d1qsfe1: 1qsf E:3-118 [20649]
Other proteins in same PDB: d1qsfa1, d1qsfa2, d1qsfb1, d1qsfd2, d1qsfe2
Details for d1qsfe1
PDB Entry: 1qsf (more details), 2.8 Å
PDB Description: structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a
SCOP Domain Sequences for d1qsfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsfe1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted
SCOP Domain Coordinates for d1qsfe1:
Click to download the PDB-style file with coordinates for d1qsfe1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qsfe1:
- d1qsfe1 appears in SCOP 1.57
- d1qsfe1 appears in the current release, SCOPe 2.08
View in 3D
