SCOPe 2.06: Domain d2vuhb_: 2vuh B:

Lineage for d2vuhb_ (2vuh B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [225556] (3 PDB entries)

8. Domain d2vuhb_: 2vuh B: [206478]
   automated match to d1xhea1
   mutant

Details for d2vuhb_

PDB Entry: 2vuh, 2.5 Å

PDB Description: crystal structure of the d55e mutant of the hupr receiver domain

PDB Compounds: (B:) hydrogenase transcriptional regulatory protein hupr1

SCOPe Domain Sequences for d2vuhb_:

Sequence; same for both SEQRES and ATOM records:

>d2vuhb_ c.23.1.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
apaillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviiceqrmpgrtgv
dfltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmf
tlarenerlslemrl

Timeline for d2vuhb_:

• d2vuhb_ first appeared in SCOPe 2.03
  
• d2vuhb_ appears in SCOPe 2.05
  
• d2vuhb_ appears in SCOPe 2.07
  
• d2vuhb_ appears in the current release, SCOPe 2.08