Lineage for d1qrne1 (1qrn E:3-118)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364249Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 364261Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (11 PDB entries)
  8. 364268Domain d1qrne1: 1qrn E:3-118 [20647]
    Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb_, d1qrnd2, d1qrne2

Details for d1qrne1

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

SCOP Domain Sequences for d1qrne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrne1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

SCOP Domain Coordinates for d1qrne1:

Click to download the PDB-style file with coordinates for d1qrne1.
(The format of our PDB-style files is described here.)

Timeline for d1qrne1: