Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
Protein Biosynthetic thiolase, C-terminal domain [419021] (1 species) |
Species Zoogloea ramigera [TaxId:350] [419503] (16 PDB entries) Uniprot P07097 |
Domain d2vu0d2: 2vu0 D:269-392 [206461] Other proteins in same PDB: d2vu0a1, d2vu0b1, d2vu0c1, d2vu0d1 automated match to d1m4ta2 complexed with coa, gol, so4 |
PDB Entry: 2vu0 (more details), 1.87 Å
SCOPe Domain Sequences for d2vu0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vu0d2 c.95.1.1 (D:269-392) Biosynthetic thiolase, C-terminal domain {Zoogloea ramigera [TaxId: 350]} iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc iesl
Timeline for d2vu0d2: