Lineage for d1ao7e1 (1ao7 E:3-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220318Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 220329Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (10 PDB entries)
  8. 220340Domain d1ao7e1: 1ao7 E:3-118 [20646]
    Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b_, d1ao7e2
    complexed with emc; mutant

Details for d1ao7e1

PDB Entry: 1ao7 (more details), 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

SCOP Domain Sequences for d1ao7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao7e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvted

SCOP Domain Coordinates for d1ao7e1:

Click to download the PDB-style file with coordinates for d1ao7e1.
(The format of our PDB-style files is described here.)

Timeline for d1ao7e1: