SCOPe 2.07: Domain d2vu0b1: 2vu0 B:2-268

Lineage for d2vu0b1 (2vu0 B:2-268)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (10 proteins)

6. Protein Biosynthetic thiolase [53905] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
   Uniprot P07097

8. Domain d2vu0b1: 2vu0 B:2-268 [206456]
   automated match to d1m4sa1
   complexed with coa, gol, so4

Details for d2vu0b1

PDB Entry: 2vu0, 1.87 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the oxidised enzyme with coenzyme a.

PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2vu0b1:

Sequence; same for both SEQRES and ATOM records:

>d2vu0b1 c.95.1.1 (B:2-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
tpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpag
egqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsm
aphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafava
sqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtv
tagnasglndgaaaallmseaeasrrg

Timeline for d2vu0b1:

• d2vu0b1 first appeared in SCOPe 2.03
  
• d2vu0b1 appears in SCOPe 2.06
  
• d2vu0b1 appears in the current release, SCOPe 2.08