Lineage for d1bd2e1 (1bd2 E:3-118)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023718Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2023746Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries)
  8. 2023773Domain d1bd2e1: 1bd2 E:3-118 [20645]
    Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b_, d1bd2d2, d1bd2e2

Details for d1bd2e1

PDB Entry: 1bd2 (more details), 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201
PDB Compounds: (E:) t cell receptor beta

SCOPe Domain Sequences for d1bd2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd2e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassypgggfyeqyfgpgtrltvte

SCOPe Domain Coordinates for d1bd2e1:

Click to download the PDB-style file with coordinates for d1bd2e1.
(The format of our PDB-style files is described here.)

Timeline for d1bd2e1: