SCOP 1.71: Domain d1bd2e1: 1bd2 E:3-118

Lineage for d1bd2e1 (1bd2 E:3-118)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (11 PDB entries)
Domain d1bd2e1: 1bd2 E:3-118 [20645]
Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b_, d1bd2d2, d1bd2e2

Details for d1bd2e1

PDB Entry: 1bd2 (more details), 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201

SCOP Domain Sequences for d1bd2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd2e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassypgggfyeqyfgpgtrltvte

SCOP Domain Coordinates for d1bd2e1:

Click to download the PDB-style file with coordinates for d1bd2e1.
(The format of our PDB-style files is described here.)

Timeline for d1bd2e1: