Lineage for d2vsxa1 (2vsx A:12-226)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128313Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (12 PDB entries)
  8. 2128329Domain d2vsxa1: 2vsx A:12-226 [206442]
    automated match to d1xtia1
    protein/RNA complex; complexed with amp

Details for d2vsxa1

PDB Entry: 2vsx (more details), 2.8 Å

PDB Description: crystal structure of a translation initiation complex
PDB Compounds: (A:) ATP-dependent RNA helicase eif4a

SCOPe Domain Sequences for d2vsxa1:

Sequence, based on SEQRES records: (download)

>d2vsxa1 c.37.1.0 (A:12-226) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
ppttqvvllsatmpndvlevttkfmrnpvrilvkk

Sequence, based on observed residues (ATOM records): (download)

>d2vsxa1 c.37.1.0 (A:12-226) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciglrdaq
ivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllppttqvvlls
atmpndvlevttkfmrnpvrilvkk

SCOPe Domain Coordinates for d2vsxa1:

Click to download the PDB-style file with coordinates for d2vsxa1.
(The format of our PDB-style files is described here.)

Timeline for d2vsxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vsxa2