SCOP 1.75: Domain d1fyte1: 1fyt E:3-118

Lineage for d1fyte1 (1fyt E:3-118)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d1fyte1: 1fyt E:3-118 [20644]
   Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd2, d1fyte2
   complexed with nag; mutant

Details for d1fyte1

PDB Entry: 1fyt, 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

PDB Compounds: (E:) T-cell receptor beta chain

SCOP Domain Sequences for d1fyte1:

Sequence; same for both SEQRES and ATOM records:

>d1fyte1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
kvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdipe
gysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvve

Timeline for d1fyte1:

• d1fyte1 first appeared (with stable ids) in SCOP 1.55
  
• d1fyte1 appears in SCOP 1.73
  
• d1fyte1 appears in SCOPe 2.01
  
• d1fyte1 appears in the current release, SCOPe 2.08