![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (11 PDB entries) |
![]() | Domain d1fyte1: 1fyt E:3-118 [20644] Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd2, d1fyte2 complexed with nag; mutant |
PDB Entry: 1fyt (more details), 2.6 Å
SCOP Domain Sequences for d1fyte1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyte1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain} kvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdipe gysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvve
Timeline for d1fyte1: