Lineage for d1fyte1 (1fyt E:3-118)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158725Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (8 PDB entries)
  8. 158729Domain d1fyte1: 1fyt E:3-118 [20644]
    Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd2, d1fyte2

Details for d1fyte1

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fyte1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyte1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
kvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdipe
gysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvve

SCOP Domain Coordinates for d1fyte1:

Click to download the PDB-style file with coordinates for d1fyte1.
(The format of our PDB-style files is described here.)

Timeline for d1fyte1: