Lineage for d1fyte1 (1fyt E:3-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2741924Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 2741947Domain d1fyte1: 1fyt E:3-118 [20644]
    Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd2, d1fyte2
    complexed with nag

Details for d1fyte1

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1
PDB Compounds: (E:) T-cell receptor beta chain

SCOPe Domain Sequences for d1fyte1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyte1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
kvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdipe
gysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvve

SCOPe Domain Coordinates for d1fyte1:

Click to download the PDB-style file with coordinates for d1fyte1.
(The format of our PDB-style files is described here.)

Timeline for d1fyte1: