SCOPe 2.08: Domain d2vsud_: 2vsu D:

Lineage for d2vsud_ (2vsu D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries)

8. Domain d2vsud_: 2vsu D: [206438]
   automated match to d3peaf_
   complexed with aco, v55

Details for d2vsud_

PDB Entry: 2vsu, 1.9 Å

PDB Description: a ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.

PDB Compounds: (D:) p-hydroxycinnamoyl coa hydratase/lyase

SCOPe Domain Sequences for d2vsud_:

Sequence; same for both SEQRES and ATOM records:

>d2vsud_ c.14.1.0 (D:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga
geawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggf
aplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqka
aemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakl
dqsrlldt

Timeline for d2vsud_:

• d2vsud_ first appeared in SCOPe 2.03
  
• d2vsud_ appears in SCOPe 2.07