SCOPe 2.04: Domain d2vsuc_: 2vsu C:

Lineage for d2vsuc_ (2vsu C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries)

8. Domain d2vsuc_: 2vsu C: [206437]
   automated match to d3hina_
   complexed with aco, v55

Details for d2vsuc_

PDB Entry: 2vsu, 1.9 Å

PDB Description: a ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.

PDB Compounds: (C:) p-hydroxycinnamoyl coa hydratase/lyase

SCOPe Domain Sequences for d2vsuc_:

Sequence; same for both SEQRES and ATOM records:

>d2vsuc_ c.14.1.0 (C:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
grwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgagea
wtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfapl
vacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaaem
glvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakldqs
rlldtggreqg

Timeline for d2vsuc_:

• d2vsuc_ first appeared in SCOPe 2.03
  
• d2vsuc_ appears in SCOPe 2.05
  
• d2vsuc_ appears in the current release, SCOPe 2.08