Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (46 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries) |
Domain d2vsuc_: 2vsu C: [206437] automated match to d3hina_ complexed with aco, v55 |
PDB Entry: 2vsu (more details), 1.9 Å
SCOPe Domain Sequences for d2vsuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vsuc_ c.14.1.0 (C:) automated matches {Pseudomonas fluorescens [TaxId: 294]} grwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgagea wtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfapl vacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaaem glvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakldqs rlldtggreqg
Timeline for d2vsuc_: