SCOPe 2.05: Domain d1bwma2: 1bwm A:3-116A

Lineage for d1bwma2 (1bwm A:3-116A)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)

8. Domain d1bwma2: 1bwm A:3-116A [20643]
   single-chain construct of beta and alpha N-domains connected by a 27-residue linker

Details for d1bwma2

PDB Entry: 1bwm

PDB Description: a single-chain t cell receptor

PDB Compounds: (A:) protein (alpha-beta t cell receptor (tcr) (d10))

SCOPe Domain Sequences for d1bwma2:

Sequence; same for both SEQRES and ATOM records:

>d1bwma2 b.1.1.1 (A:3-116A) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvl

Timeline for d1bwma2:

• d1bwma2 first appeared (with stable ids) in SCOP 1.55
  
• d1bwma2 appears in SCOPe 2.04
  
• d1bwma2 appears in SCOPe 2.06
  
• d1bwma2 appears in the current release, SCOPe 2.08