SCOP 1.65: Domain d1bwma2: 1bwm A:3-116A

Lineage for d1bwma2 (1bwm A:3-116A)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (16 PDB entries)

8. Domain d1bwma2: 1bwm A:3-116A [20643]
   single-chain construct of beta and alpha N-domains connected by a 27-residue linker
   mutant

Details for d1bwma2

PDB Entry: 1bwm

PDB Description: a single-chain t cell receptor

SCOP Domain Sequences for d1bwma2:

Sequence; same for both SEQRES and ATOM records:

>d1bwma2 b.1.1.1 (A:3-116A) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvl

Timeline for d1bwma2:

• d1bwma2 first appeared (with stable ids) in SCOP 1.55
  
• d1bwma2 appears in SCOP 1.63
  
• d1bwma2 appears in SCOP 1.67
  
• d1bwma2 appears in the current release, SCOPe 2.08